Endometrial cancer gene database Home
Endometrial cancer database
Gene information | Literature | T1/T2 Diff | Expression | lncRNA | Regulation | Mutation | Homolog | Interaction

Basic Information

Gene ID

387

Name

RHOA

Synonym

ARH12|ARHA|RHO12|RHOH12;ras homolog family member A;RHOA;ras homolog family member A

Definition

Aplysia ras-related homolog 12|h12|oncogene RHO H12|ras homolog gene family, member A|rho cDNA clone 12|small GTP binding protein RhoA|transforming protein RhoA

Position

3p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Heterotrimeric G-protein signaling pathway-Gq alpha and Go alpha mediated pathway;PANTHER;P00027

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

N-cadherin signaling events;PID Curated;200180

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Sema4D mediated inhibition of cell attachment and migration;PID Reactome;500073

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

Lissencephaly gene (LIS1) in neuronal migration and development;PID Curated;200114

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

S1P4 pathway;PID Curated;200043

Pathway

Pancreatic secretion;KEGG PATHWAY;hsa04972

Pathway

ccr3 signaling in eosinophils;PID BioCarta;100215

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

role of egf receptor transactivation by gpcrs in cardiac hypertrophy;PID BioCarta;100221

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

rho-selective guanine exchange factor akap13 mediates stress fiber formation;PID BioCarta;100248

Pathway

IL2-mediated signaling events;PID Curated;200082

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

G beta:gamma signalling through PI3Kgamma;PID Reactome;500439

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Thromboxane A2 receptor signaling;PID Curated;200069

Pathway

Noncanonical Wnt signaling pathway;PID Curated;200016

Pathway

Angiogenesis;PANTHER;P00005

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

role of pi3k subunit p85 in regulation of actin organization and cell migration;PID BioCarta;100211

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

d4gdi signaling pathway;PID BioCarta;100191

Pathway

thrombin signaling and protease-activated receptors;PID BioCarta;100082

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

PI3K/AKT signalling;PID Reactome;500639

Pathway

E-cadherin signaling in keratinocytes;PID Curated;200125

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

S1P1 pathway;PID Curated;200071

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Endogenous TLR signaling;PID Curated;200177

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

ras signaling pathway;PID BioCarta;100047

Pathway

Ras Pathway;PANTHER;P04393

Pathway

Hemostasis;Reactome;REACT:604

Pathway

role of mal in rho-mediated activation of srf;PID BioCarta;100114

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Aurora B signaling;PID Curated;200010

Pathway

Axonal growth stimulation;PID Reactome;500618

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events regulated by Ret tyrosine kinase;PID Curated;200058

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

rho cell motility signaling pathway;PID BioCarta;100041

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

PLK1 signaling events;PID Curated;200087

Pathway

Arf6 downstream pathway;PID Curated;200079

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

S1P5 pathway;PID Curated;200063

Pathway

Axon guidance mediated by semaphorins;PANTHER;P00007

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

mTOR signaling pathway;PID Curated;200080

Pathway

Axonal growth inhibition (RHOA activation);PID Reactome;500619

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Netrin-mediated signaling;PID Curated;200074

Disease

Hamman-Rich syndrome;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Cancer;FunDO

Disease

Labor, Premature;FunDO

Disease

Vaccinia;FunDO

External Links

Links to Entrez Gene

387

Links to WikiGenes

387

Links to tumor suppressors

387

Links to dbEMT

387

Links to iHOP

387

Sequence Information

Nucleotide Sequence

>387 : length: 1926
GTGGATGAGCTGTGAGTGCGCGCGCGTGCGCGGGGCCGCGACCTGTGCCGGCTCGAGCCC
GCTGGGCACTCGGAGGCGCGCACGTCGTTCCCCGCCCTCCCGCCGCCGCCCGCCCTCGCT
CTCTCGCGCTACCCTCCCGCCGCCCGCGGTCCTCCGTCGGTTCTCTCGTTAGTCCACGGT
CTGGTCTTCAGCTACCCGCCTTCGTCTCCGAGTTTGCGACTCGCGGACCGGCGTCCCCGG
CGCGAAGAGGCTGGACTCGGATTCGTTGCCTGAGCAATGGCTGCCATCCGGAAGAAACTG
GTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGAC
CAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTG
GATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGC
CTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGC
CCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCC
AACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGG
CGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCA
AACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGA
GAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCT
GGGTGCCTTGTCTTGTGAAACCTTGCTGCAAGCACAGCCCTTATGCGGTTAATTTTGAAG
TGCTGTTTATTAATCTTAGTGTATGATTACTGGCCTTTTTCATTTATCTATAATTTACCT
AAGATTACAAATCAGAAGTCATCTTGCTACCAGTATTTAGAAGCCAACTATGATTATTAA
CGATGTCCAACCCGTCTGGCCCACCAGGGTCCTTTTGACACTGCTCTAACAGCCCTCCTC
TGCACTCCCACCTGACACACCAGGCGCTAATTCAAGGAATTTCTTAACTTCTTGCTTCTT
TCTAGAAAGAGAAACAGTTGGTAACTTTTGTGAATTAGGCTGTAACTACTTTATAACTAA
CATGTCCTGCCTATTATCTGTCAGCTGCAAGGTACTCTGGTGAGTCACCACTTCAGGGCT
TTACTCCGTAACAGATTTTGTTGGCATAGCTCTGGGGTGGGCAGTTTTTTGAAAATGGGC
TCAACCAGAAAAGCCCAAGTTCATGCAGCTGTGGCAGAGTTACAGTTCTGTGGTTTCATG
TTAGTTACCTTATAGTTACTGTGTAATTAGTGCCACTTAATGTATGTTACCAAAAATAAA
TATATCTACCCCAGACTAGATGTAGTATTTTTTGTATAATTGGATTTCCTAATACTGTCA
TCCTCAAAGAAAGTGTATTGGTTTTTTAAAAAAGAAAGTGTATTTGGAAATAAAGTCAGA
TGGAAAATTCATTTTTTAAATTCCCGTTTTGTCACTTTTTCTGATAAAAGATGGCCATAT
TACCCCTTTTCGGCCCCATGTATCTCAGTACCCCATGGAGCTGGGCTAAGTAAATAGGAA
TTGGTTTCACGCCTGAGGCAATTAGACACTTTGGAAGATGGCATAACCTGTCTCACCTGG
ACTTAAGCATCTGGCTCTAATTCACAGTGCTCTTTTCTCCTCACTGTATCCAGGTTCCCT
CCCAGAGGAGCCACCAGTTCTCATGGGTGGCACTCAGTCTCTCTTCTCTCCAGCTGACTA
AACTTTTTTTCTGTACCAGTTAATTTTTCCAACTACTAATAGAATAAAGGCAGTTTTCTA
AAAAAA

Protein Sequence

>387 : length: 193
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL