Endometrial cancer gene database Home
Endometrial cancer database
Gene information | Literature | T1/T2 Diff | Expression | lncRNA | Regulation | Mutation | Homolog | Interaction

Basic Information

Gene ID

1523

Name

CUX1

Synonym

CASP|CDP|CDP/Cut|CDP1|COY1|CUTL1|CUX|Clox|Cux/CDP|GOLIM6|Nbla10317|p100|p110|p200|p75;cut-like homeobox 1;CUX1;cut-like homeobox 1

Definition

CCAAT displacement protein|cut homolog|golgi integral membrane protein 6|homeobox protein cux-1|protein CASP|putative protein product of Nbla10317

Position

7q22.1

Gene Type

protein-coding

External Links

Links to Entrez Gene

1523

Links to WikiGenes

1523

Links to tumor suppressors

1523

Links to dbEMT

1523

Links to iHOP

1523

Sequence Information

Nucleotide Sequence

>1523 : length: 14122
CGGTCCGAGCCGCGATCGCCGCGCGCCTGGGGGCTCCGGCGGCCCCCGGTGACCTGCGGC
GCCGGGTCCCTTCCTTGCGTCCCCTCGGGGCTTCTGCCCTCTCTGCAGGGCCCGCCATGG
AGCGCGCGGCGGGTGCGCTCGGAGATGCCTTCTCGGGCCGGGTTCTCGAAAGCAGAGCCC
CGGGGGCCCGTTGGGACCGTGGCATGCCGGGCGGTGGTCCGCGCGCGGAGTCCCCGGCGC
CGCGGGGGGACCGTGCCGGGGCTCCCCGGCCCGCGCCCGAGTCGCCGCCGTGCCCAAGGG
GCGAGTGCCTGCCTGCCACCCCCCGCCCGGAGGAGCGGCGCACCCTTAGGGTCCGCCCCG
CACGTGCCAGCTCGGCGCCCGCGGCGCCGGGACAGCCCCGGGACTCTGCCAGGTGGATGT
TGTGCGTAGCCGGAGCCAGGTTGAAGAGAGAACTCGATGCCACCGCAACGGTATTGGCGA
ACCGGCAGGATGAAAGTGAGCAGTCCAGAAAGCGGCTTATCGAACAGAGCCGGGAGTTCA
AGAAGAACACTCCAGAGGATTTGCGCAAGCAGGTAGCGCCGCTGCTGAAGAGTTTCCAAG
GAGAGATTGATGCACTGAGTAAAAGAAGCAAGGAAGCTGAAGCAGCTTTCTTGAATGTCT
ACAAAAGATTGATTGACGTCCCAGATCCCGTACCAGCTTTGGATCTCGGACAGCAACTCC
AGCTCAAAGTGCAGCGCCTGCACGATATTGAAACAGAGAACCAGAAACTTAGGGAAACTC
TGGAAGAATACAACAAGGAATTTGCTGAAGTGAAAAATCAAGAGGTTACGATAAAAGCAC
TTAAAGAGAAAATCCGAGAATATGAACAGACACTGAAGAACCAAGCCGAAACCATAGCTC
TTGAGAAGGAACAGAAGTTACAGAATGACTTTGCAGAAAAGGAGAGAAAGCTGCAGGAGA
CACAGATGTCCACCACCTCAAAGCTGGAGGAAGCTGAGCATAAGGTTCAGAGCCTACAAA
CAGCCCTGGAAAAAACTCGAACAGAATTATTTGACCTGAAAACCAAATACGATGAAGAAA
CTACTGCAAAGGCCGACGAGATTGAAATGATCATGACGGACCTTGAAAGGGCAAACCAGA
GGGCAGAGGTGGCTCAGAGAGAGGCGGAGACCTTAAGGGAACAGCTCTCATCGGCCAATC
ACTCCCTCCAGCTGGCCTCACAGATCCAGAAGGCACCAGACGTGGAGCAGGCCATAGAGG
TGCTGACCCGCTCCAGCCTAGAAGTTGAGTTGGCCGCCAAGGAGCGGGAGATCGCACAGC
TGGTGGAGGACGTGCAGAGACTCCAGGCCAGCCTCACCAAGCTGCGGGAGAATTCGGCCA
GCCAGATCTCACAGCTTGAGCAGCAGCTGAGCGCCAAAAACAGCACACTCAAACAACTGG
AAGAAAAACTCAAAGGCCAGGCTGACTATGAAGAGGTGAAGAAAGAGCTGAACATTCTGA
AGTCCATGGAGTTTGCACCGTCCGAGGGCGCTGGGACACAGGATGCGGCCAAGCCCCTGG
AGGTGCTGTTGCTGGAGAAGAACCGCTCGCTGCAGTCCGAGAACGCCGCGCTGCGCATCT
CCAACAGCGACCTGAGCGGGTCAGCCAGGAGGAAAGGGAAAGACCAGCCTGAAAGTCGGC
GCCCGGGATCTTTGCCGGCCCCCCCTCCTTCTCAGTTGCCCCGCAACCCGGGGGAGCAGG
CTTCCAATACTAATGGTACACACCAGTTCTCACCAGCGGGGTTAAGTCAAGACTTTTTCA
GCTCATCCCTGGCAAGCCCCAGCCTACCCCTGGCTTCTACAGGAAAATTTGCACTAAACT
CTCTTCTCCAGCGGCAGCTAATGCAGTCCTTCTACTCCAAGGCTATGCAGGAAGCCGGAA
GCACAAGCATGATTTTTTCAACAGGTCCATACAGCACAAACTCCATATCTTCCCAAAGTC
CATTACAACAAAGCCCAGATGTCAATGGCATGGCCCCATCCCCCAGCCAGTCAGAAAGTG
CTGGGAGCGTCTCCGAGGGCGAGGAGATGGACACTGCAGAAATCGCCCGGCAGGTCAAAG
AGCAGCTGATTAAGCACAATATCGGACAACGTATTTTCGGACATTATGTGTTGGGACTGT
CTCAAGGGTCCGTGAGCGAGATTCTGGCCCGGCCCAAGCCATGGAATAAACTGACTGTTC
GTGGCAAGGAGCCATTTCACAAGATGAAACAGTTCCTCTCCGATGAGCAGAACATCCTGG
CCCTCCGTAGCATCCAAGGCAGACAAAGAGAGAATCCAGGCCAGAGCCTGAACAGACTAT
TTCAGGAAGTACCGAAACGAAGAAATGGGTCTGAAGGTAACATCACCACCCGGATCCGAG
CCTCGGAGACTGGCTCTGATGAAGCCATCAAGTCCATCCTAGAGCAAGCCAAGAGGGAGC
TCCAAGTGCAGAAAACTGAGCCGGCCCAGCCTTCCTCCGCATCCGGCAGCGGGAACTCTG
ATGACGCCATCCGCTCCATCCTGCAGCAAGCCCGCCGGGAGATGGAGGCCCAGCAGGCTG
CCCTCGACCCTGCCTTAAAGCAGGCACCACTGTCCCAGAGTGACATCACCATCCTCACCC
CCAAGCTTCTGTCCACCTCGCCCATGCCCACCGTGTCCAGCTACCCACCTCTCGCCATCT
CCCTGAAGAAGCCCTCCGCAGCTCCTGAGGCCGGTGCCTCTGCTCTGCCGAACCCCCCGG
CCCTCAAAAAGGAGGCCCAGGACGCCCCCGGGCTGGACCCCCAGGGAGCAGCCGATTGTG
CACAAGGGGTCCTGAGACAGGTGAAAAATGAGGTGGGCCGCAGCGGTGCCTGGAAGGACC
ACTGGTGGAGCGCGGTGCAGCCGGAGAGAAGAAATGCCGCCTCCTCCGAGGAGGCCAAGG
CCGAAGAAACGGGCGGCGGGAAAGAGAAGGGCAGCGGTGGCAGCGGAGGTGGCAGCCAGC
CTCGGGCCGAGCGCAGTCAGCTCCAGGGACCCTCGTCGTCAGAGTACTGGAAGGAGTGGC
CCAGCGCTGAGTCCCCATACTCCCAGAGCTCAGAGCTGAGTCTGACCGGGGCCAGCCGCA
GCGAGACACCACAGAACAGCCCCCTGCCATCCTCCCCGATCGTGCCCATGTCCAAGCCCA
CCAAGCCCTCGGTCCCCCCGCTGACCCCCGAGCAGTACGAGGTCTACATGTACCAGGAGG
TGGACACCATCGAGCTCACCCGGCAGGTTAAGGAAAAGCTGGCCAAGAACGGCATCTGCC
AGAGAATCTTCGGGGAGAAGGTGCTGGGCCTGTCCCAGGGCAGCGTCAGCGACATGCTGT
CCCGACCGAAGCCATGGAGCAAGCTGACGCAGAAAGGCCGAGAACCCTTCATCCGGATGC
AGCTCTGGCTGAACGGCGAGCTAGGCCAGGGTGTTCTACCCGTCCAGGGCCAGCAGCAAG
GGCCAGTCCTCCACTCCGTGACATCGCTCCAGGACCCGCTGCAGCAGGGCTGTGTGAGCT
CAGAAAGCACTCCAAAGACCTCCGCCAGCTGCAGCCCTGCCCCTGAGTCCCCGATGAGTT
CCAGTGAGTCGGTGAAGAGCCTGACCGAGCTGGTCCAGCAGCCCTGTCCCCCCATCGAGG
CGAGCAAGGACAGCAAGCCACCAGAGCCCAGTGACCCGCCAGCATCCGACTCCCAGCCCA
CAACCCCGCTGCCTCTCTCCGGACACTCGGCCCTCAGCATCCAAGAATTAGTAGCCATGT
CCCCGGAGCTGGACACCTACGGCATAACCAAGCGGGTGAAGGAGGTGCTGACGGACAACA
ACCTCGGCCAGCGCTTATTTGGGGAGACCATCTTAGGGCTCACCCAAGGCTCTGTCTCTG
ACCTCCTTGCCCGCCCCAAACCCTGGCATAAGCTCAGTCTGAAAGGACGAGAGCCCTTCG
TCCGGATGCAGCTGTGGCTGAACGACCCCAACAATGTGGAGAAGCTGATGGACATGAAAC
GGATGGAGAAGAAAGCCTACATGAAGCGGCGGCACAGCTCAGTCAGTGACAGCCAGCCCT
GCGAACCGCCCTCTGTCGGCACCGAGTACAGCCAGGGCGCCAGCCCCCAGCCCCAGCACC
AGCTGAAGAAACCCCGGGTGGTGCTGGCTCCGGAGGAGAAGGAGGCGCTGAAACGAGCGT
ATCAGCAAAAGCCATACCCGTCACCAAAAACCATCGAAGACCTCGCCACCCAGCTCAACC
TGAAAACCAGCACCGTCATCAACTGGTTCCACAACTACAGGTCTCGGATCCGCAGAGAAC
TGTTCATTGAGGAAATTCAGGCCGGGAGTCAGGGCCAGGCGGGCGCCAGCGACTCACCCT
CGGCCCGCAGCGGCCGGGCGGCGCCCAGCTCGGAGGGCGACAGCTGCGACGGCGTGGAGG
CCACTGAGGGCCCAGGCAGCGCCGACACCGAGGAGCCCAAGTCTCAGGGAGAGGCCGAGC
GGGAGGAGGTGCCGCGGCCGGCGGAGCAGACGGAGCCGCCGCCCTCGGGGACCCCGGGCC
CGGACGACGCCCGCGACGACGACCACGAGGGAGGCCCCGTGGAAGGCCCGGGGCCCCTGC
CCAGCCCCGCCTCCGCGACCGCCACCGCCGCGCCCGCGGCCCCCGAGGACGCCGCTACCT
CAGCCGCCGCCGCGCCGGGGGAGGGCCCCGCGGCCCCGAGCTCCGCGCCGCCGCCCAGCA
ACAGCAGCAGCAGCAGCGCCCCCCGCAGGCCCAGCTCGCTGCAGAGCCTTTTCGGCCTCC
CCGAGGCCGCGGGCGCCCGGGACTCGCGCGACAACCCCCTGCGCAAGAAGAAGGCCGCGA
ACTTGAACAGCATCATCCACCGCCTGGAGAAGGCCGCCAGCCGGGAGGAACCTATCGAAT
GGGAGTTCTGAGGGGCCGCGGCCCTGGGGCGGGCAGCCAGGCTGGGCCGCAAGGGCCTGG
ACGGGGTCGGACGGGGCAGGCGCTGCGGACACCGTGGCCTGGGCTTGGCCCGCGGCCTGC
ACCGACCCCGGGCCGGACCTGAGCCCGCAGCCCAGACCCCCTCCACGGTCCGCGGCCTGC
ACCGACCCGAGGCCCAGATCCAAGGCCGCGGCCCAGACCCACTCTGCGGCCCGGGCCGAC
CCTGCGGCCTCCACCAACCCCGCGGCCCAGACCCAGCCCGCGGCCTGGACCCCTGGACCG
CTTTGCGCACTTACCGCCCTGCGGGCCACAGGGCAAAATCGCCATAGGCCAAGGTGCATA
TAGAAAACAAAGGAGCATTAAGCCCAATCTATGTCGTGTTTTCAAGGAAGAAAACGGAAA
TGTGTGGTCGAGCTTTTTTGTACCCTGAAGTGTTTTTTTTATTGCCCTAAGTGATTTCCA
CAGGTTCTGGAATAACTCTTACAGCTTTGCCTTGTGTCCTCCTGTTCCGTGTGGGCTTTA
AAAGAAAAAAAATCAAACCCACATATTAAAAGGGGGCTTTTTATCTGCCATCTAATGGCT
TCAGAGCGATAATACACTATTATCTTCTTAAACCAGGAAAAAATAAAAGGGGGGGTGGGA
TTTTTCAGAAAAATTAAAAAAGAAAGTTTTTGTAGCTGTTCAGTTGCCACTAAGAGATTG
CACAGTCAAAACGACTCTAAACACACTAGTTTGGATTCCTAAATATTTTCAAGAAAAGAA
TCTTCTCGTTTGAAACTTTGAATTAAAATAAAACACATTTACTCCACATATTTTTTAACA
AAAAGAAAACGTCACATCAGGAAACTCTGATTTTGTGGTAGCTGACATAGTGTTTTCTTG
TACGTGAATAGAATCCTGACATGTAGTGCACATTGATGTATAGCTTTAACTGACCCTGGG
TTTTGCAGACCAGGGTTTGTTTAATACACTCCATTCTAGGCCAAATCAGGACAAAAAAAA
GAAAAAAAAAGAAAAAAAAAAAAGAAAAGATCCGAATCTAGGTATTTTATAATCTGCTTT
TTAACCTCTAACCGCAGAGCACGCTGATCAGACCTCATATCTTGGAGGTTTAGGAGACAA
GTTAGAACTGTAGCATGTACCTGTTAATTTTGTTTAATTTATGGTGTCTCAATCTGTCTG
TGCGTCTGCACGTGTGCAAGCATTGAAAGAAAGGAGAGAGTAGTCCGGGCGAGCACAGCA
GGCAGTTCCAGGGCCAGACGGGCCCATCCCCAAGTAGATAGCAGTCTACGGATCTCTCTC
TGGCACAGAAGGCACCTCACCTCACACCACTCTCCTGGATACCTGATGAACTGAGCCCTC
CCAGGGGAAGACACTCCCCAGGCCTGGGCAGGGCTTACACGCGCACTCTCTCTCTTCTTT
CCCTTTTTCTTCCCACCGCAAGCACTGATGACCCTGTTGAACTCGTGGGAAACTTCCTTT
CTCTGCAGGAGAGAGAACGTGGCATTCTGGGCTCCCCACTCCCATCCCTGTAGAAATGGC
CCAAACTCACACCAAAACGTGGATGCTCTTCAACTTCCAAACCTACCATTTGCCCTTCTT
TCATTTCGCCTCTTAGTTCTTTTTATGCACAGTTTTAGGGCAGTCTAAGTACAAACTGAA
AGTCTAACTTGTCTCTGATTCCTCCCTTGTCTATGTGTATATGCGTGAGAATAGAGGCGG
GTGAGAGTGTGCGTGCGTGTGCGTGTGTGCAATTTTATACGTCTGTGTATTTTCTTAAGT
ACCTGTGCACACGTAGAGTGCATTACTGCCACCTTTTTCAATAAGCTGTTTTATCAGTTA
CGGCTTCTACAAGTTTGCTAATTTAGACTTCTTTATTGCCATATCTTTAAACTAACAATA
GATGATTTCGGTATATATATATATTTTTTTTTGCTTATTTATAGGTGCTGTATTTTATTA
TCTGATTGTTAGGAAGGGATGAAAGGGGCAAATATTCTTTAGAGGGATAGACTGCCGGCA
GTATTGGGTATAATTTACAAGATGTAGTTGTCATACTGTATATTACTGATTGAAAACTTT
TTGACCGTATTGTGTATCATTGAAACCTTTGTCTTAGGTCAACATCTTTGGATGACATTT
TAATGGTGCATTCATTATTTCTTAAGTTTAATTAATATTACTTTTTTTTTTATTTGGGGG
GTGGGAGGGAGTTATAATTTTAAAGGTATGCTCTGGCTGTTCCACCTCCGTGTGCTTGTT
AATTAACTTGTAGGACTTTGACTGTAAGATGTGAAACCACGTTTCTTGCATGATGTTTTA
GAGATTATTTCATTTACAGTCTTTTAACCTGCAGCTGCAGCACTTAGTTCACGTTTTCAC
AAATTTCAAGAGTCACTACACTAAAGACAATGCCTTTTCATGAATAAGAAGTTTTCAGAA
GGCTCTAGGGGGCTGGGAGGCAGGCTGTTCGTTTGTCTTTTGTTGGGGGTATCATTTCTG
AACTTGAAATCCAGTTCAGGGAGAAGAGAATTCAAAATTAGAGGAGCTTAAGGGGACACG
GGTCAACATCTAGCTCGATTCAGGTGCATTGAGAAGAGTGAGTTCACATCGGTGACCCTT
AGGACAGTGAGTGGCAGAGCCCTGACGACTGTGGTGTCCTCTCCACAAAACCCTCAAGGG
ACTTTTGTCATCATGTGTGATGAATCTTTAAATATCGTCTAATTTTCATAAGAATGAAAA
GAAGTTAACAGGAAATAGTAGGCTAGGGTTTAGTTTTAAAGGCATGACTGTTATTTACAA
AGGTGTTAAATCTGAGGAAATTGACAAATACAGATTTGTCCATTCTAGTGGCCAAACAGT
AACAGTCTAAAATGCAGTCATTTTGACCCTCCCAAGCAATTTAGTCATATGTGTTGTTTT
CTCTTTTCTGTTTTTACTTCTTAGATTTTTAACTAGGTTACTGTTGGTTCCCATTCTGTC
TTTTTTGCCAGACTTACATCTGGTGCCAGATACAATCAGTTGGTTAAATTTTGCTTGCAG
TTCTGTGTATTTTTTTTCCTCTATTATTTATTTTTTTAAAAAAAATAGAGATCCTAACCT
TAGATCTTTGATGTGAAGCTAGCACTGTCTGTAATACTTCTAAGAGCTGCCACTAAAATA
ATACAGCAATCCGTGGCCAGGGGAGCACCCCCTCCTGGTTGGGCCCCTCAGTTGGAGTCT
AAGGGTTAATCTCTCATCTTGCTAAGCAGTATTCAAGTGCCTTGAACAGTGTCCCCTCGG
CATGGCTCCCCTTCAGCAGGCTGGCATTCCAAGCAGTGGCCCCCGCAGGCAGCCGACCCC
CTTCCTCTTCACGCTCTATGAGTTTAAAAAGCTGATTTGTACCTCTCCCCTGGGGGAAAC
GGTTCCATATAAAACACTAACACTTAATTACAAGCTCCATTATGCCATTTTAAATGGCTT
CTTTTTGTTAATTGGAGGCATTGTTCATAACTTAAGGCTTTTGCCATTAACTTAGCTGGC
TAAGCAGAGGCTCGGGGTAAAATCAGTGTTTGCATTTAGCCTCTTGACCCGGAGTTCCGG
CCCAAGCTCCCTTGTGATAGCCGAGATGGCAGGTGTGTGAGTTCTGTCCTAGACCTGTGC
CCAACTCACTTCCACCCCAGAGGAGTCTTCTGTCCTCCTCCCCAACCCCCGAGCTCCCTG
GTAACCTCCTCTTGAACTTCTGTATCAGTGAAGACATCTGTGGTTTCTGCTCACCAGACC
TCTCTTTAGAAAGGGTTATCAGAGCCATGGAGCTTAGCTCAATTGGATTCTTCTAGACGA
TCTTAGGAGGCATCTTGGCATGAGGCAGCTTCTAAGCGTCTCCTGGGACAGGATTGGGGT
GACAGCCCAGGGATGCATGCATGGGAGAACTCTCTGAGAAATGCCAGGATCGTGGCTCAC
AGGGACCCACCATCAAAACCTGCTACTTTGTGCAAGTAATTGAGGCAAAAGATACCAGTC
GACAGCCTCCCTGGGGTAGATCCCTTGTACCTCCAAAGTACAAATACCTCCCTGCTCAGT
TTCCTTCCTGTCGCCATCTTTGTTTTCTTCCCATTGAAAAACCATCCTGTCTGATGTGGA
CGTTCAGGTCTGCTGGTTGGCGGTCCGGGCCCAGAGTGCAGCAGAGCTCTGGGTTAAATA
TTCCTTTCTGGCCACCGCCCAAGCCCAGGTGGCCAGCTCTCATACCCCATCTCCCTCCTT
GGCCAGGGCCAGCATCAGGCGTGCAGCTCATGACCAGTTTACACAGGCTGCAAAGAGATC
GCTGTGGGCCTCGGCTGACTACTTTAAGATTATGCCACAGCCAGGCCCTAAAAAGAGAGG
GGAACAGGAGTCCCCAGGTGAGCTCTCTGACGGGCAGGTGCCTTCCCGACTAAGGTTGGA
CTGGATGACTTTGTTCCTCCTGCATGCATGTCCTTTGATGCAAGGGTGATCAATGAACTC
TGTTGACATTCTATGCAATGTTTTTCATTCCTCTGATTTTAGCAAAGCAAATCTTACTGA
AAAATAGCAGAGCCAGGGGAACAGACGCATGTCCTTCTGGGAGTCACACAAAAGCAGAGA
GATTTTGAACTGAGGGGCGACAGCCTTTGCCTTAAATGCAGTATGACAGGCGCTTCTTGG
CAGACCAGTAAAAACAAAAGCCCATAGACCTTACTCATCCCAAGGCCGACAAGCCAGCTG
TACAGGGCGAGATGTAGCAACACGGGGCATGAGCGGTGGGCGTGCTGGGCTATTTGCTGT
GGTACTTTAGGCTGGAGGTTTGGCTCCTGTGCTGCCGGTGGGGGGCCCTGTCCCTCCCCA
GATGTCCTCCCTCTTCTTCACACTCCTCATTGTCCCTTCTACCTCACTAACCTGTCTTCT
CCATCTGATGTCACCCAGAACCACACCCCACAGAACTGTGAGGCACGTGGGCTGGAGAGA
GCAGAAAAGCTGCCAGCGCAGCAGACACGAACATCCCTCTGCCTGGTGGGCCGGCTTTGT
GTGTCTCTCCTTTTGTGAGCGCAACACGGACAAACAGCTGTGCTCTGCAAGGCACACGGA
TGTTTCCCTTCCACCTGTTCCCAAAGCTCCAGCAGCTGTTTCTTTTGCAGGCAGGGCGTG
GTCTCGGGGCTCCGAGGGTCTTGTCTTTGGTCCGCCTTCCTTTCTGTCCAGTCCTGCTCA
GCTGTTAAGATCCATCATGGCCATTATCCTTGTCCCGGACTGCCCCAAAGTTCCCAGCTG
GCTTTGGGGAACACTGTAGCTCTTGGGTGTCTCTTGTCTCTGGCATGGTTTTAGCGTCAC
TGCGAACACTCCTTTGCAAACATCAAACATCTCAAAGACGGAAAAGGATAGATGGCTTCC
TCCAGCCTACACGCCCCGTCCACAGTGGCATCACCCTCTTATCCCAAAAGAATATGCCAG
TTCCCATCCAGCACCGAAGAAAATCAGCTCCTGGGGCTGGTGGTTGGAGGTGGGTCTGTC
CACTGTGGGGGCCAAAGTGTTCCCCTGCTGGAGACAGTTTGCAAGTAAGAACCTAAGGAT
GGGGACAGCATCCTGTGCTTGGGCATTGACCAGCCAAAGCTCACATTTAGAAAGCCCTCA
GTGCTTCTGTGGTTTCACCTGGGCATCGACGACATTAGGGAAGCCTTTGTGACCACAAGG
GCAGGGCTTGTGCCCTGAGTGGCGAGGTGGTGACCTGAGGCCAGTGTGATGTGGTTGGAT
CTCAGCGTGTACTGAATGCCAGTCTGGCCGGCACACTCGAACGCTAAGAGAATGGTCCAA
TTTGATGATCTTATTTCTATTTCGATCAGGTTTTGACTTTTTGTAGATGAAAACTACCAG
GGAAAAGGGGAAGCAGGTACCCAATAAAGTTTAGAAAGATCCAGTCTGTGAAACCCTTAG
AGATGGGCTGAAAGTTAAGTCCACCAACCCTTGGGCTTAATCAGGACGGAAGAGGAGGGG
GTGTGGGGGGCAGAGCGTAAAACAAGCCCCAGCCCTACTCCCGGCCCCCCAGCCCAGTCT
TCCCAATCCCAGAGGCCCCGGCGGCCTGTGCTCCTCACCACCCTGGTCAGGGGAATAGAA
GGAAATGCAATTTCCGCCTGTCTGCCCGACTTCCAAAAACTGCCTCCTCCTGCCCAGGCC
TCTCCCACCACCACCTTCCCTCCAAAGATAACCGTGTCCATGCCATCCGTGGCATCATCT
CGAGTTTTCATTTTTGGATGAAGTGACATTTAGCTTTAACAAGACATTTCCAAAGCGCCT
AGTCTCCTCCAAAATGCTAACTTTAAAAGTTGGGCATTGTAGGCGAAAAATCCCAAAAAA
AAAAAAAGACAAAAAAAAAAGGCTGGCGAGAGAAAGACATTTGGCTATGCATAAATGTGC
ACTTCCCCCATGCCCCCGTTCTTAAACTCTTAAGATGCCTTTGAGTTGCTTTTCATGAAT
CCTTTTAGTTTACCCGATAATGTTAAGAAAGCATTAGTCTACGTTACTGTAATTTCTGTA
GTGTTTACGCTTTAATTTCTACCACAAAATATGCTATATGCTATGTATCAAGCTTTCTGT
AATCAGAAAGAAAAGGTGCCTTATATCCCAATGTCACGGCTACATCCCTATGGAAATTAA
TCAGAAGCACAGTGTGTACGGAAGCATTGGGACTTCTGCTGGTGAAACAAGAGACCATTC
AGCAAGACACATTGAAGTGGCACGGAGCTGCTTTTGTTTTATAATTCTTTTTTCCCCCCT
TTTCCTTCTTCTTTTTTATTATTTTATTATTTTTTTTGTACTTTGCTTTAAACGGAAAGC
ACTTAAATAGATGACTATGTGTAAAAGCTCTGTGCAATTGAAATCATTTTTCTTCATTTT
AAAAAAATAACGTATTGCACACCAAATGAACTCAAAGTAAGCTTTAGACCAGGACGATTC
AGGTTATGAATGAGTTTGTTCACTGTAGTTCCGTTTGTTCATGAACCGAAGGGAAAACAG
GCCTCCCCGACTCCCTCCAGTCTCCCAGCCTGCCTCTTGGTGACCACTGTGCTGGGCGTG
CAGGGCCCGCGGGCTCTGGCCGGAGCCGCTGGCCTGACGAGGCAGGATAGGGAGTATCCG
TGATTCAGAAGCTGAGACCCTTCCCCAGTGTCTGAGGCCACAGCCATCCCTTCCAGCACT
TAATCTTGTCTTGTTGAAATGGACTGACTGCTACTGACCTGCCGGCGTGCGTGAGGGTGA
TTATAAAAGGATGTTTCCTTGAGAAAAAAAAAATTATTTCTATCCTCTTCTATTTATTAT
TAGGTTAATCATTTAAGTACTTATCAGGAGTGTATTGTTATTTTGTGTTTTGTTGTCATA
AATGCTTTTTGCTGTCACTCTAGTGGTTACTATCCTCTGCCTTCCTCTCCTCCCCTACTC
CCCCAGAGAACCAAGGCGTCTGGGGGATTGACTGGGGGGCAGAGGGGGTTTCCCCAGCAA
AATCAAACACCTGTCTCCAGAGTAGCCACTCAAAAACTGGTGGTCTCTATGTGTCTAACT
TTTTAAATGAGAGTGTTTATGAACAAAAAAATTTACCAACGTGTGAGGGAGTTGCTGAGT
TGAAGAATGCTCGCTTGAGGAGCTTCAGAGGAATCTTAGCAAAGCCAAGTTCAGTTCCCC
AAAGCCTCCTAGAGCCTCTGGTAAGACTTCTGGGTTCATGAAGTTTCGGCGAGCCGTGGT
CAGAGAGGGCGCGGTGGCCTGGCCAAGACTTTACCTCCAAGCGAGAGAGTGATTTCTTGC
AAGGCCCGCATGGGTTGATACGTTTTGGTTGGTTTTTTGTTGTTGTTTTTCTTGCGTACA
AAGTTGGTCAAAACCATCTTTCAAAGCAACAGTGTTTTGTAGTACCAGGCTGTGGCTTGA
GGGCTCACCTAGGAGATCATAGGCAGAGGGCCCCTTTCCCCTATAGGTGGTTCAACGTGG
AGGAAGGTTGGGTGTGGAGATTGCTTGCTGTGGCCCCAAGCTCAGCCAGCAGGACACCCA
GTTGTTGCCAATCAGGTGTGAAGGTGAGGCGCCCTGCCTTGATCCCATGGGCCCAGCAGA
AGGAAACTTACCCCAGGCCAAGGCAAGGGCCCTGCTCACCCCAAGGTAGGCTGGGAAGAG
CATCTCTTTCCATATCATCACCTCCCCTTCTCCAAGATTGCCGGGGGCCCTGATTTTGTT
CTCTCTTTGAAAGAAACCCTCCACCGAAACAATGGTCCCCATCTCCCCAGAAGCCTTTTT
TTTTTTCATTTTTCTCTAATTAGTCTATGCATTTCTCTCTCTCAAACCATCTTCTGCCTC
TTCCCTTGAGAAAACGGGCATCTCACGTACCCCCATCTGAGACCTCTTGGAAAAAAAAAA
TCCCGTGTATTCTGGAGATGTGAGAATTCACCCAAAATTCTTAAAACATTGGAGAATAGC
TTGTTATAAAATAAAAGTGGGGGTAAAAAGAAGGTGGTTTTCCCCACATCCCTTTGCATT
GAATAAGAGACCTAGTTCTTTGCGTTTGTGCAATAACTCTTTGCTGCTTGCCTTGAGAGC
GGGTAGCACCACGCTCCTGTCCAGACTACTAACAGCACAAGACGCACTCACAGGGTGGCG
GAATCTTCCGGAAAACTCTCTATAAGCTCAGCTCCCCCCACCCCACCCCCACTCTAGCGT
TTTGTCACGTCTTACATTTTAGCAGTATTTTATATTTTCTGTAACGCACCAAGTCTTAGA
TCTTTCTAGAGCTTGTTTGTTCATCCTCACAATCACAGATTTTTTTCTCCAATCCTCACA
GAGACCCAATTGACCAAAAAAGAAAAAAGGAAAAAAAAAAAGTCGTCTTTTTTTTTTTTT
TTTGTACAAATCGCTTTGAGATGCCTCTGGTGTGTTGCTGTGTGACATCTCTCTGGTAAC
ATTTTATTTCTTGCTATTTGTTTTTCTACATTAAGAGTCAAAGTTGACCTGGCTGGCGTG
GGGGTGGGGGAGGCACCCGTCGGCCCCTTGGTGTTGTCCCTCTGTCTTTGGTTAGCCATA
CGATGTTTGTTCTCAGCACTGTACAACGGTCCCTATATAATACGGAGAAGCAATATCACT
GTATGAGACTCACACCATGTATTATTATTCACTAGCACCCTAGGTGTGATAATTGAAGTA
AATATCTTTTATACAAACACAA

Protein Sequence

>1523 : length: 1604
MERAAGALGDAFSGRVLESRAPGARWDRGMPGGGPRAESPAPRGDRAGAPRPAPESPPCP
RGECLPATPRPEERRTLRVRPARASSAPAAPGQPRDSARWMLCVAGARLKRELDATATVL
ANRQDESEQSRKRLIEQSREFKKNTPEDLRKQVAPLLKSFQGEIDALSKRSKEAEAAFLN
VYKRLIDVPDPVPALDLGQQLQLKVQRLHDIETENQKLRETLEEYNKEFAEVKNQEVTIK
ALKEKIREYEQTLKNQAETIALEKEQKLQNDFAEKERKLQETQMSTTSKLEEAEHKVQSL
QTALEKTRTELFDLKTKYDEETTAKADEIEMIMTDLERANQRAEVAQREAETLREQLSSA
NHSLQLASQIQKAPDVEQAIEVLTRSSLEVELAAKEREIAQLVEDVQRLQASLTKLRENS
ASQISQLEQQLSAKNSTLKQLEEKLKGQADYEEVKKELNILKSMEFAPSEGAGTQDAAKP
LEVLLLEKNRSLQSENAALRISNSDLSGSARRKGKDQPESRRPGSLPAPPPSQLPRNPGE
QASNTNGTHQFSPAGLSQDFFSSSLASPSLPLASTGKFALNSLLQRQLMQSFYSKAMQEA
GSTSMIFSTGPYSTNSISSQSPLQQSPDVNGMAPSPSQSESAGSVSEGEEMDTAEIARQV
KEQLIKHNIGQRIFGHYVLGLSQGSVSEILARPKPWNKLTVRGKEPFHKMKQFLSDEQNI
LALRSIQGRQRENPGQSLNRLFQEVPKRRNGSEGNITTRIRASETGSDEAIKSILEQAKR
ELQVQKTEPAQPSSASGSGNSDDAIRSILQQARREMEAQQAALDPALKQAPLSQSDITIL
TPKLLSTSPMPTVSSYPPLAISLKKPSAAPEAGASALPNPPALKKEAQDAPGLDPQGAAD
CAQGVLRQVKNEVGRSGAWKDHWWSAVQPERRNAASSEEAKAEETGGGKEKGSGGSGGGS
QPRAERSQLQGPSSSEYWKEWPSAESPYSQSSELSLTGASRSETPQNSPLPSSPIVPMSK
PTKPSVPPLTPEQYEVYMYQEVDTIELTRQVKEKLAKNGICQRIFGEKVLGLSQGSVSDM
LSRPKPWSKLTQKGREPFIRMQLWLNGELGQGVLPVQGQQQGPVLHSVTSLQDPLQQGCV
SSESTPKTSASCSPAPESPMSSSESVKSLTELVQQPCPPIEASKDSKPPEPSDPPASDSQ
PTTPLPLSGHSALSIQELVAMSPELDTYGITKRVKEVLTDNNLGQRLFGETILGLTQGSV
SDLLARPKPWHKLSLKGREPFVRMQLWLNDPNNVEKLMDMKRMEKKAYMKRRHSSVSDSQ
PCEPPSVGTEYSQGASPQPQHQLKKPRVVLAPEEKEALKRAYQQKPYPSPKTIEDLATQL
NLKTSTVINWFHNYRSRIRRELFIEEIQAGSQGQAGASDSPSARSGRAAPSSEGDSCDGV
EATEGPGSADTEEPKSQGEAEREEVPRPAEQTEPPPSGTPGPDDARDDDHEGGPVEGPGP
LPSPASATATAAPAAPEDAATSAAAAPGEGPAAPSSAPPPSNSSSSSAPRRPSSLQSLFG
LPEAAGARDSRDNPLRKKKAANLNSIIHRLEKAASREEPIEWEF